CacheBy
Atlas Antibodies Anti-BRAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRAP Antibody

상품 한눈에 보기

인간 BRAP 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체이며, PrEST 항원으로 정제됨. 인간, 마우스, 랫트 반응성 확인. 안정적인 PBS/glycerol 버퍼에 보존.

카탈로그번호
HPA040357-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040357-100 Anti-BRAP Antibody, BRCA1 associated protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040357-25 Anti-BRAP Antibody, BRCA1 associated protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRAP Antibody

Anti-BRAP Antibody

Target Information

  • Target Protein: BRCA1 associated protein
  • Target Gene: BRAP
  • Alternative Gene Names: BRAP2, IMP, RNF52
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human BRAP

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAIIHQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEA

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000029458 (84%)
  • Rat ENSRNOG00000046497 (83%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.