
Atlas Antibodies Anti-BLNK Antibody
상품 한눈에 보기
인간 BLNK 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 토끼 유래 IgG 항체이며, 정제 과정에 PrEST 항원을 사용했습니다. RNA-seq 데이터 및 재조합 발현을 통한 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BLNK Antibody
B-cell linker
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간의 발현을 교차 검증
- WB (Recombinant Expression Validation): 재조합 발현 단백질을 이용한 Western blot 검증
- ICC: 세포 수준에서의 단백질 발현 확인
Product Description
Polyclonal Antibody against Human BLNK
Alternative Gene Names
BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | B-cell linker |
| Target Gene | BLNK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 유사도 |
|---|---|---|
| Mouse | ENSMUSG00000061132 | 89% |
| Rat | ENSRNOG00000013967 | 88% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide preservative
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLNK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.