AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BLOC1S4 Antibody
상품 한눈에 보기
Human BLOC1S4 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. 고순도의 Affinity Purified 제품이며, PBS와 글리세롤 버퍼에 보존제를 포함합니다. 생쥐 및 랫드와 높은 서열 유사성을 가집니다.
- 카탈로그번호
- HPA043840-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043840-100 Anti-BLOC1S4 Antibody, biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043840-25 Anti-BLOC1S4 Antibody, biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BLOC1S4 Antibody
Anti-BLOC1S4 Antibody
Target: Biogenesis of lysosomal organelles complex-1, subunit 4 (Cappuccino)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human BLOC1S4.
Alternative Gene Names
BCAS4L, CNO, FLJ11230
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino |
| Target Gene | BLOC1S4 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR |
Species Reactivity
- Verified: Human
- Interspecies Sequence Identity:
- Rat ENSRNOG00000054224 (87%)
- Mouse ENSMUSG00000060708 (85%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.