CacheBy
Atlas Antibodies Anti-BLOC1S6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BLOC1S6 Antibody

상품 한눈에 보기

인간 BLOC1S6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. Rabbit 유래 IgG 형식으로 PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 Mouse, Rat과 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039928-100 Anti-BLOC1S6 Antibody, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039928-25 Anti-BLOC1S6 Antibody, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BLOC1S6 Antibody

Anti-BLOC1S6 Antibody

Target Protein: Biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant Expression Validation
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human BLOC1S6


Alternative Gene Names

HPS9, PA, PLDN

Open Datasheet


Target Information

항목 내용
Target Protein Biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
Target Gene BLOC1S6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000005804 (91%), Rat ENSRNOG00000037160 (90%)

Antigen Sequence:

FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.