Atlas Antibodies Anti-BLOC1S6 Antibody

상품 한눈에 보기

인간 BLOC1S6 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. Rabbit 유래 IgG 형식으로 PrEST 항원으로 친화 정제됨. Human 반응성 확인 및 Mouse, Rat과 높은 서열 유사성 보유.

카탈로그번호: HPA039928-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039928-100 Anti-BLOC1S6 Antibody, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039928-25 Anti-BLOC1S6 Antibody, biogenesis of lysosomal organelles complex-1, subunit 6, pallidin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-BLOC1S6 Antibody

Anti-BLOC1S6 Antibody

Target Protein: Biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) – Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human BLOC1S6

Alternative Gene Names

HPS9, PA, PLDN

Open Datasheet

Target Information

항목	내용
Target Protein	Biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
Target Gene	BLOC1S6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000005804 (91%), Rat ENSRNOG00000037160 (90%)

Antigen Sequence:

FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand