Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)

Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)

상품 한눈에 보기

Ataxin 1 단백질 검출용 Thermo Fisher Scientific의 Mouse Monoclonal Antibody (Clone N76/8). Western blot, IHC, ICC, IP에 적합하며 Human, Mouse, Rat 반응성. Protein G 정제, 1 mg/mL 농도, -20°C 보관.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 03. 오후 10:58
소모품
MA527666
Thermo Fisher Scientific MA527666 Ataxin 1 Monoclonal Antibody (N76/8) 100 ug pk
CAS: -단위: pk
재고문의재고: -
775,200
(VAT포함)852,720
소모품
MA527666
재고문의재고: -
Thermo Fisher Scientific MA527666 Ataxin 1 Monoclonal Antibody (N76/8) 100 ug pk
CAS: -단위: pk
775,200
(VAT포함)852,720

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 1:1,000
Immunohistochemistry (PFA fixed) (IHC (PFA)) 1:100
Immunocytochemistry (ICC/IF) 1:100
Immunoprecipitation (IP) Assay-Dependent

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Clone N76/8
Immunogen Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Conjugate Unconjugated
Form Liquid
Concentration 1 mg/mL
Purification Protein G
Storage Buffer PBS, pH 7.4, with 50% glycerol
Contains 0.1% sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2735120

Additional Formats

Product Specific Information

  • 1 µg/mL of MA5-27666 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot using Goat anti-mouse IgG:HRP as secondary antibody.
  • Detects approximately 85 kDa.
  • Formerly sold as clone S76-8.

Target Information

The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem, and spinal cord.
ADCA is divided into three groups (types I–III). ADCAI is genetically heterogeneous, with loci SCA1, 2, 3, 4, and 6 on different chromosomes. ADCAII (SCA7) presents with retinal degeneration, and ADCAIII (SCA5) is a pure cerebellar syndrome.
These diseases are caused by expansion of CAG repeats, resulting in elongated polyglutamine tracts. The function of ataxins is not fully known. The SCA1 locus is mapped to chromosome 6, with diseased alleles containing 41–81 CAG repeats versus 6–39 in normal alleles.
At least two transcript variants encoding the same protein have been identified.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0