Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)
Ataxin 1 단백질 검출용 Thermo Fisher Scientific의 Mouse Monoclonal Antibody (Clone N76/8). Western blot, IHC, ICC, IP에 적합하며 Human, Mouse, Rat 반응성. Protein G 정제, 1 mg/mL 농도, -20°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)
Thermo Fisher Scientific Ataxin 1 Monoclonal Antibody (N76/8)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:1,000 |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1:100 |
| Immunocytochemistry (ICC/IF) | 1:100 |
| Immunoprecipitation (IP) | Assay-Dependent |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Clone | N76/8 |
| Immunogen | Synthetic peptide amino acids 164–197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Purification | Protein G |
| Storage Buffer | PBS, pH 7.4, with 50% glycerol |
| Contains | 0.1% sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2735120 |
Additional Formats
Product Specific Information
- 1 µg/mL of MA5-27666 detects Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot using Goat anti-mouse IgG:HRP as secondary antibody.
- Detects approximately 85 kDa.
- Formerly sold as clone S76-8.
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem, and spinal cord.
ADCA is divided into three groups (types I–III). ADCAI is genetically heterogeneous, with loci SCA1, 2, 3, 4, and 6 on different chromosomes. ADCAII (SCA7) presents with retinal degeneration, and ADCAIII (SCA5) is a pure cerebellar syndrome.
These diseases are caused by expansion of CAG repeats, resulting in elongated polyglutamine tracts. The function of ataxins is not fully known. The SCA1 locus is mapped to chromosome 6, with diseased alleles containing 41–81 CAG repeats versus 6–39 in normal alleles.
At least two transcript variants encoding the same protein have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.