Thermo Fisher Scientific DC-SIGN (CD209) Polyclonal Antibody
DC-SIGN(CD209) 단백질을 인식하는 Rabbit Polyclonal 항체입니다. Western blot, IHC, Flow Cytometry에 적합하며, 인체 시료 반응성이 검증되었습니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific DC-SIGN (CD209) Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1x10⁶ cells | 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746084 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a transmembrane receptor often referred to as DC-SIGN due to its expression on the surface of dendritic cells and macrophages. The encoded protein plays an important role in the innate immune system, recognizing various pathogens including parasites and viruses.
The protein consists of three domains:
- N-terminal transmembrane domain
- Tandem-repeat neck domain
- C-type lectin carbohydrate recognition domain
The extracellular region (neck and lectin domains) functions as both a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on microbial and endogenous cell surfaces. The neck region mediates homo-oligomerization, enhancing multivalent ligand binding. Variations in the neck domain repeat number affect ligand-binding ability.
DC-SIGN is closely related to L-SIGN (GeneID 10332) but differs in ligand-binding properties and tissue distribution. Alternative splicing generates multiple variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.