
Thermo Fisher Scientific DC-SIGN (CD209) Polyclonal Antibody
DC-SIGN(CD209) 단백질을 인식하는 Rabbit Polyclonal 항체입니다. Western blot, IHC, Flow Cytometry에 적합하며, 인체 시료 반응성이 검증되었습니다. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1x10⁶ cells | 1 publication |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746084 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a transmembrane receptor often referred to as DC-SIGN due to its expression on the surface of dendritic cells and macrophages. The encoded protein plays an important role in the innate immune system, recognizing various pathogens including parasites and viruses.
The protein consists of three domains:
- N-terminal transmembrane domain
- Tandem-repeat neck domain
- C-type lectin carbohydrate recognition domain
The extracellular region (neck and lectin domains) functions as both a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on microbial and endogenous cell surfaces. The neck region mediates homo-oligomerization, enhancing multivalent ligand binding. Variations in the neck domain repeat number affect ligand-binding ability.
DC-SIGN is closely related to L-SIGN (GeneID 10332) but differs in ligand-binding properties and tissue distribution. Alternative splicing generates multiple variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific CD24 Polyclonal Antibody
599,200원

Thermo Fisher Scientific
Thermo Fisher Scientific CD200 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific DC-SIGN (CD209) Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CD22 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific CD163 Polyclonal Antibody
565,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|