CacheBy
Atlas Antibodies Anti-ODF3B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ODF3B Antibody

상품 한눈에 보기

인체 ODF3B 단백질에 대한 폴리클로날 항체로, 정자 꼬리의 외부 조밀섬유 단백질을 표적합니다. IHC를 통한 정교한 직교 검증 제공. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫과 높은 서열 유사성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062837-100 Anti-ODF3B Antibody, outer dense fiber of sperm tails 3B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062837-25 Anti-ODF3B Antibody, outer dense fiber of sperm tails 3B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ODF3B Antibody

Anti-ODF3B Antibody

Target: outer dense fiber of sperm tails 3B
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human ODF3B.

Open Datasheet

Target Information

항목 내용
Target Protein outer dense fiber of sperm tails 3B
Target Gene ODF3B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000047394 (67%), Rat ENSRNOG00000037060 (66%)

Antigen Sequence:
SFFEDLSKTPGPCAYQVVSPGVYKSRAPQFTILARTSLPQDNTRKPGPAAYNVDQHRK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.