
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ODAM Antibody
상품 한눈에 보기
인간 ODAM 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 사람에 대한 반응성이 검증되었으며, 안정적인 PBS-글리세롤 버퍼에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036279-100 Anti-ODAM Antibody, odontogenic, ameloblast associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036279-25 Anti-ODAM Antibody, odontogenic, ameloblast associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ODAM Antibody
Anti-ODAM Antibody
Odontogenic, ameloblast associated
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 용도에 적합
Product Description
Polyclonal Antibody against Human ODAM
Alternative Gene Names
- APin
- FLJ20513
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Odontogenic, ameloblast associated |
| Target Gene | ODAM |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000009580 (71%), Rat ENSRNOG00000023372 (70%) |
Antigen Information
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: IPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGA
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



