CacheBy
Atlas Antibodies Anti-ODAM Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ODAM Antibody

상품 한눈에 보기

인간 ODAM 단백질에 특이적인 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 사람에 대한 반응성이 검증되었으며, 안정적인 PBS-글리세롤 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036279-100 Anti-ODAM Antibody, odontogenic, ameloblast associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036279-25 Anti-ODAM Antibody, odontogenic, ameloblast associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ODAM Antibody

Anti-ODAM Antibody

Odontogenic, ameloblast associated

면역세포화학(ICC) 등 다양한 연구 용도에 적합

Product Description

Polyclonal Antibody against Human ODAM

Alternative Gene Names

  • APin
  • FLJ20513

Open Datasheet

Target Information

항목 내용
Target Protein Odontogenic, ameloblast associated
Target Gene ODAM
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000009580 (71%), Rat ENSRNOG00000023372 (70%)

Antigen Information

  • Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: IPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.