AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ODF2L Antibody
상품 한눈에 보기
Human ODF2L 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반 PBS buffer에 보존됨. 인간에 대한 반응성이 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028095-100 Anti-ODF2L Antibody, outer dense fiber of sperm tails 2-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028095-25 Anti-ODF2L Antibody, outer dense fiber of sperm tails 2-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ODF2L Antibody
Anti-ODF2L Antibody
Target: outer dense fiber of sperm tails 2-like (ODF2L)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against Human ODF2L.
Alternative Gene Names
- KIAA1229
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | outer dense fiber of sperm tails 2-like |
| Target Gene | ODF2L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLLPLFKDTIEKINFENANLSALNLKISEQKEILIKELDTFKSVKLALEHLLRKRDYKQTGDNLSSMLLENLTDNESENTNLKKKVFEKE |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000028256 | 66% |
| Rat | ENSRNOG00000014059 | 64% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.