Atlas Antibodies Anti-NUP37 Antibody

상품 한눈에 보기

Human NUP37 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합. 독립 항체 검증으로 높은 신뢰성 확보. PrEST 항원을 이용한 친화 정제 방식. Human에 반응하며 Mouse, Rat과 높은 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA073708-100 Anti-NUP37 Antibody, nucleoporin 37kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA073708-25 Anti-NUP37 Antibody, nucleoporin 37kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nucleoporin 37kDa
Supplier: Atlas Antibodies

Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human NUP37

항목	내용
Target Protein	nucleoporin 37kDa
Target Gene	NUP37
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGSGLSWHRTLPLCVIGGDHKLLFWVTEV
Verified Species Reactivity	Human
Interspecies Identity	Mouse (88%), Rat (86%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand