CacheBy
Atlas Antibodies Anti-NUP43 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUP43 Antibody

상품 한눈에 보기

Human NUP43 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립 항체 검증을 통해 신뢰성 확보. Human, Mouse, Rat에 반응하며, PrEST 항원으로 친화 정제됨. 세포핵공복합체 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027291-100 Anti-NUP43 Antibody, nucleoporin 43kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027291-25 Anti-NUP43 Antibody, nucleoporin 43kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUP43 Antibody

Anti-NUP43 Antibody

Target: nucleoporin 43kDa


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human NUP43


Alternative Gene Names

bA350J20.1, FLJ13287

Open Datasheet


Target Information

항목 내용
Target Protein nucleoporin 43kDa
Target Gene NUP43
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT

Species Reactivity

  • Verified Species: Human, Mouse, Rat
  • Interspecies Identity:
    • Rat ENSRNOG00000049505 (94%)
    • Mouse ENSMUSG00000040034 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.