
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NUP43 Antibody
상품 한눈에 보기
Human NUP43 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립 항체 검증을 통해 신뢰성 확보. Human, Mouse, Rat에 반응하며, PrEST 항원으로 친화 정제됨. 세포핵공복합체 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027291-100 Anti-NUP43 Antibody, nucleoporin 43kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027291-25 Anti-NUP43 Antibody, nucleoporin 43kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NUP43 Antibody
Anti-NUP43 Antibody
Target: nucleoporin 43kDa
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NUP43
Alternative Gene Names
bA350J20.1, FLJ13287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleoporin 43kDa |
| Target Gene | NUP43 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT |
Species Reactivity
- Verified Species: Human, Mouse, Rat
- Interspecies Identity:
- Rat ENSRNOG00000049505 (94%)
- Mouse ENSMUSG00000040034 (93%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



