
Atlas Antibodies Anti-NUP43 Antibody
상품 한눈에 보기
Human NUP43 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립 항체 검증을 통해 신뢰성 확보. Human, Mouse, Rat에 반응하며, PrEST 항원으로 친화 정제됨. 세포핵공복합체 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUP43 Antibody
Target: nucleoporin 43kDa
Recommended Applications
- IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NUP43
Alternative Gene Names
bA350J20.1, FLJ13287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleoporin 43kDa |
| Target Gene | NUP43 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT |
Species Reactivity
- Verified Species: Human, Mouse, Rat
- Interspecies Identity:
- Rat ENSRNOG00000049505 (94%)
- Mouse ENSMUSG00000040034 (93%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUP37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP50 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP50 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.