Atlas Antibodies Anti-NUP43 Antibody

상품 한눈에 보기

Human NUP43 단백질을 타깃으로 하는 Rabbit Polyclonal 항체로 IHC 및 WB에 적합. 독립 항체 간 비교를 통한 검증 완료. Human, Mouse, Rat에 반응하며 PrEST 항원을 이용해 친화정제됨. 40% glycerol 기반 PBS buffer에 보존.

카탈로그번호: HPA027126-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027126-100 Anti-NUP43 Antibody, nucleoporin 43kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027126-25 Anti-NUP43 Antibody, nucleoporin 43kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NUP43 Antibody

Anti-NUP43 Antibody

Target Protein: nucleoporin 43kDa
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human NUP43.

Alternative Gene Names

bA350J20.1
FLJ13287

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	nucleoporin 43kDa
Target Gene	NUP43
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000049505 (94%), Mouse ENSMUSG00000040034 (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.