
Atlas Antibodies Anti-NUP35 Antibody
상품 한눈에 보기
인간 NUP35 단백질을 인식하는 폴리클로날 항체입니다. IHC 및 WB 등 다양한 응용에 적합합니다. 토끼 유래 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인간, 생쥐, 랫드 간 높은 종간 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUP35 Antibody
Target Protein: nucleoporin 35kDa
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human NUP35.
Alternative Gene Names
- MP44
Antigen Information
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCID
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009290 | 99% |
| Mouse | ENSMUSG00000091900 | 99% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUP37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP35 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP214 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP155 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.