CacheBy
Atlas Antibodies Anti-NUP43 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUP43 Antibody

상품 한눈에 보기

인간 NUP43 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. 독립 항체 비교 검증을 통해 단백질 발현을 확인하였으며, 친화성 정제된 고품질 Rabbit IgG 항체입니다. Human, Mouse, Rat 종에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028500-100 Anti-NUP43 Antibody, nucleoporin 43kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028500-25 Anti-NUP43 Antibody, nucleoporin 43kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUP43 Antibody

Anti-NUP43 Antibody

Target Protein: nucleoporin 43kDa
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human NUP43


Alternative Gene Names

  • bA350J20.1
  • FLJ13287

Open Datasheet


Specifications

항목 내용
Target Protein nucleoporin 43kDa
Target Gene NUP43
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000049505 (94%), Mouse ENSMUSG00000040034 (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Independent
WB Independent

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.