Atlas Antibodies Anti-NUP43 Antibody

상품 한눈에 보기

인간 NUP43 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 응용에 적합합니다. 독립 항체 비교 검증을 통해 단백질 발현을 확인하였으며, 친화성 정제된 고품질 Rabbit IgG 항체입니다. Human, Mouse, Rat 종에 반응합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028500-100 Anti-NUP43 Antibody, nucleoporin 43kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028500-25 Anti-NUP43 Antibody, nucleoporin 43kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: nucleoporin 43kDa
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human NUP43

항목	내용
Target Protein	nucleoporin 43kDa
Target Gene	NUP43
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	FDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHYHTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRT
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000049505 (94%), Mouse ENSMUSG00000040034 (93%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS	Material Safety Data Sheet