
Atlas Antibodies Anti-NUP155 Antibody
상품 한눈에 보기
인간 NUP155 단백질을 인식하는 토끼 폴리클로날 항체입니다. WB 및 ICC에 적합하며, RNA-seq 데이터 기반 정교한 Orthogonal 검증을 거쳤습니다. Affinity purification으로 높은 특이성과 신뢰성을 제공합니다. 인체 NUP155 연구에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUP155 Antibody
Target: nucleoporin 155kDa
Type: Polyclonal Antibody against Human NUP155
Recommended Applications
- WB (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression cell lines.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human NUP155.
Alternative Gene Names
KIAA0791, N155
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleoporin 155kDa |
| Target Gene | NUP155 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022142 (85%), Rat ENSRNOG00000013411 (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUP35 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP214 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP155 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP210L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUP210L Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.