CacheBy
Atlas Antibodies Anti-NT5C3A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NT5C3A Antibody

상품 한눈에 보기

Human NT5C3A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 사용 가능. 재조합 발현 단백질로 검증되었으며, 고순도의 친화 정제 방식으로 제조됨. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA010630-100 Anti-NT5C3A Antibody, 5`-nucleotidase, cytosolic IIIA 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010630-25 Anti-NT5C3A Antibody, 5`-nucleotidase, cytosolic IIIA 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NT5C3A Antibody

Anti-NT5C3A Antibody

Target: 5`-nucleotidase, cytosolic IIIA

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human NT5C3A

Alternative Gene Names

cN-III, hUMP1, NT5C3, p36, P5`N-1, PN-I, POMP, PSN1, UMPH, UMPH1

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein 5`-nucleotidase, cytosolic IIIA
Target Gene NT5C3A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000029780 (93%), Rat ENSRNOG00000005981 (93%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.