
Atlas Antibodies Anti-NT5C3A Antibody
상품 한눈에 보기
Human NT5C3A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 사용 가능. 재조합 발현 단백질로 검증되었으며, 고순도의 친화 정제 방식으로 제조됨. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NT5C3A Antibody
Target: 5`-nucleotidase, cytosolic IIIA
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human NT5C3A
Alternative Gene Names
cN-III, hUMP1, NT5C3, p36, P5`N-1, PN-I, POMP, PSN1, UMPH, UMPH1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | 5`-nucleotidase, cytosolic IIIA |
| Target Gene | NT5C3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKI |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000029780 (93%), Rat ENSRNOG00000005981 (93%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NT5DC4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NT5C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NT5C3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NT5C1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NSUN7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.