
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NT5C Antibody
상품 한눈에 보기
Human NT5C 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human과 Rat에 반응합니다. 세포질 5’,3’-nucleotidase 연구용으로 권장됩니다.
- 카탈로그번호
- HPA021581-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021581-100 Anti-NT5C Antibody, 5`, 3`-nucleotidase, cytosolic 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021581-25 Anti-NT5C Antibody, 5`, 3`-nucleotidase, cytosolic 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NT5C Antibody
Anti-NT5C Antibody
Target Information
- Target Protein: 5’, 3’-nucleotidase, cytosolic
- Target Gene: NT5C
- Alternative Gene Names: cdN, DNT-1, DNT1, PN-I, UMPH2
Product Description
Polyclonal Antibody against Human NT5C.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence used for immunization.
Antigen Sequence:
GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL
Verified Species Reactivity
- Human
- Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000020736 | 85% |
| Rat | ENSRNOG00000003650 | 83% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



