CacheBy
Atlas Antibodies Anti-NT5C1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NT5C1A Antibody

상품 한눈에 보기

Human NT5C1A 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. PBS와 글리세롤 기반 버퍼에 보존제가 포함되어 안정적입니다.

카탈로그번호
HPA050283-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050283-100 Anti-NT5C1A Antibody, 5`-nucleotidase, cytosolic IA 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050283-25 Anti-NT5C1A Antibody, 5`-nucleotidase, cytosolic IA 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NT5C1A Antibody

Anti-NT5C1A Antibody

Target Information

  • Target Protein: 5'-nucleotidase, cytosolic IA
  • Target Gene: NT5C1A
  • Alternative Gene Names: CN-I, CN-IA, CN1, CN1A, MGC119199, MGC119201

Product Description

Polyclonal antibody against Human NT5C1A.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRALFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000015283 (94%)
  • Mouse ENSMUSG00000054958 (93%)

IHC (Immunohistochemistry)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도 및 조건은 사용자가 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.