CacheBy
Atlas Antibodies Anti-NSUN5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSUN5 Antibody

상품 한눈에 보기

인간 NSUN5 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB(Orthogonal), ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 정제된 고특이성 항체. RNA-seq 데이터 기반 Orthogonal 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045590-100 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045590-25 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSUN5 Antibody

Anti-NSUN5 Antibody

Target: NOP2/Sun domain family, member 5 (NSUN5)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Orthogonal validation)
  • ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using Western Blot (WB) by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against human NSUN5.


Alternative Gene Names

NOL1, FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein NOP2/Sun domain family, member 5
Target Gene NSUN5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001450 (88%), Mouse ENSMUSG00000000916 (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Antigen Sequence

QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.