
Atlas Antibodies Anti-NSUN5 Antibody
상품 한눈에 보기
인간 NSUN5 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB(Orthogonal), ICC 등 다양한 응용에 적합. Rabbit 유래 IgG로 정제된 고특이성 항체. RNA-seq 데이터 기반 Orthogonal 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NSUN5 Antibody
Target: NOP2/Sun domain family, member 5 (NSUN5)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation:
Protein expression validated using Western Blot (WB) by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against human NSUN5.
Alternative Gene Names
NOL1, FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NOP2/Sun domain family, member 5 |
| Target Gene | NSUN5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000001450 (88%), Mouse ENSMUSG00000000916 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NSUN5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NSUN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NSUN5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NSUN5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NSUN3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.