CacheBy
Atlas Antibodies Anti-NSUN5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSUN5 Antibody

상품 한눈에 보기

Human NSUN5 단백질을 인식하는 고품질 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품입니다. Rabbit 유래 IgG 항체이며, Affinity purification 방식으로 정제되었습니다.

카탈로그번호
HPA046867-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046867-100 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046867-25 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSUN5 Antibody

Anti-NSUN5 Antibody

Target Protein: NOP2/Sun domain family, member 5
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Orthogonal validation)
  • Immunocytochemistry (ICC)

Orthogonal validation:
Protein expression verified by comparison to RNA-seq data in high and low expression cell lines.


Product Description

Polyclonal antibody against Human NSUN5.


Alternative Gene Names

NOL1, FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL

Open Datasheet


Specifications

항목 내용
Target Protein NOP2/Sun domain family, member 5
Target Gene NSUN5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001450 (88%), Mouse ENSMUSG00000000916 (88%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


Antigen Sequence

QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.