Atlas Antibodies Anti-NSUN5 Antibody

상품 한눈에 보기

Human NSUN5 단백질에 특이적인 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 단백질 발현 확인. Affinity purification 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA020536-100 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA020536-25 Anti-NSUN5 Antibody, NOP2/Sun domain family, member 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: NOP2/Sun domain family, member 5
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against Human NSUN5.

(NOL1), FLJ10267, NOL1R, NSUN5A, p120, WBSCR20, WBSCR20A, Ynl022cL

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

QLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLIL

Species	Ortholog ID	Identity
Mouse	ENSMUSG00000000916	88%
Rat	ENSRNOG00000001450	88%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand