Atlas Antibodies Anti-NRIP3 Antibody
상품 한눈에 보기
Human NRIP3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. Rabbit 호스트, IgG 아이소타입. PrEST 항원으로 정제된 고순도 항체이며, 인간에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NRIP3 Antibody
Target: Nuclear receptor interacting protein 3 (NRIP3)
Type: Polyclonal Antibody against Human NRIP3
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression)
Validation: Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human NRIP3.
Alternative Gene Names
- C11orf14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear receptor interacting protein 3 |
| Target Gene | NRIP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKA |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000034825 | 90% |
| Rat | ENSRNOG00000013290 | 86% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.