CacheBy
Atlas Antibodies Anti-NRP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRP1 Antibody

상품 한눈에 보기

Human NRP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. CD304/VEGF165R 등 대체 유전자명으로 알려진 neuropilin 1을 타깃하며, 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030278-100 Anti-NRP1 Antibody, neuropilin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030278-25 Anti-NRP1 Antibody, neuropilin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRP1 Antibody

Anti-NRP1 Antibody

Target Information

  • Target Protein: neuropilin 1
  • Target Gene: NRP1
  • Alternative Gene Names: CD304, NRP, VEGF165R

Product Description

Polyclonal antibody against human NRP1 (neuropilin 1).

  • Immunohistochemistry (IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000025810): 97%
  • Rat (ENSRNOG00000010744): 92%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as ligand

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.