CacheBy
Atlas Antibodies Anti-NRIP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRIP3 Antibody

상품 한눈에 보기

인간 NRIP3 단백질에 대한 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 특이적으로 반응하며 높은 종간 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA058827-100 Anti-NRIP3 Antibody, nuclear receptor interacting protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058827-25 Anti-NRIP3 Antibody, nuclear receptor interacting protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRIP3 Antibody

Anti-NRIP3 Antibody

Target: Nuclear receptor interacting protein 3 (NRIP3)
Type: Polyclonal Antibody against Human NRIP3

  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Alternative Gene Names

  • C11orf14

Open Datasheet (PDF)

Target Information

  • Target Protein: Nuclear receptor interacting protein 3
  • Target Gene: NRIP3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    KLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000034825 90%
Rat ENSRNOG00000013290 86%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.