
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NRIP3 Antibody
상품 한눈에 보기
인간 NRIP3 단백질에 대한 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합합니다. 토끼 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간에 특이적으로 반응하며 높은 종간 서열 유사성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA058827-100 Anti-NRIP3 Antibody, nuclear receptor interacting protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058827-25 Anti-NRIP3 Antibody, nuclear receptor interacting protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NRIP3 Antibody
Anti-NRIP3 Antibody
Target: Nuclear receptor interacting protein 3 (NRIP3)
Type: Polyclonal Antibody against Human NRIP3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
Alternative Gene Names
- C11orf14
Target Information
- Target Protein: Nuclear receptor interacting protein 3
- Target Gene: NRIP3
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
KLGSSKDMQPHNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVKA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000034825 | 90% |
| Rat | ENSRNOG00000013290 | 86% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



