CacheBy
Atlas Antibodies Anti-NRAP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRAP Antibody

상품 한눈에 보기

Human NRAP 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 독립 검증을 통해 단백질 발현 확인. PrEST 항원을 이용한 친화 정제 방식. 인간 반응성 확인 및 쥐·마우스와 69% 서열 일치. 연구용 단백질 검출에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037953-100 Anti-NRAP Antibody, nebulin-related anchoring protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037953-25 Anti-NRAP Antibody, nebulin-related anchoring protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRAP Antibody

Anti-NRAP Antibody

Target: Nebulin-related anchoring protein (NRAP)
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human NRAP
Open Datasheet


Target Information

항목 내용
Target Protein Nebulin-related anchoring protein
Target Gene NRAP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TFTSVYHTPLNLNVRTFPEAISGIHDQEDGEQCKSVFHWDMKSKDKEGAPNRQPLANERAYWTGYGEGNAWCPGALPDPEIVRMVE

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000016714 (69%)
Mouse ENSMUSG00000049134 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.