CacheBy
Atlas Antibodies Anti-NRBF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NRBF2 Antibody

상품 한눈에 보기

Human NRBF2 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 연구용으로 적합. COPR1 등 다양한 유전자명으로 알려진 NRBF2를 타겟하며, PrEST 항원을 이용해 친화정제됨. 사람에 대해 검증된 반응성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA059477-100 Anti-NRBF2 Antibody, nuclear receptor binding factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059477-25 Anti-NRBF2 Antibody, nuclear receptor binding factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NRBF2 Antibody

Anti-NRBF2 Antibody

Target: nuclear receptor binding factor 2 (NRBF2)


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human NRBF2.


Alternative Gene Names

COPR1, COPR2, DKFZp564C1664, FLJ30395

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nuclear receptor binding factor 2
Target Gene NRBF2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFM
Verified Species Reactivity Human
Ortholog Identity Rat ENSRNOG00000000641 (95%), Mouse ENSMUSG00000075000 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.