CacheBy
Atlas Antibodies Anti-NR6A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NR6A1 Antibody

상품 한눈에 보기

인간 NR6A1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤과 PBS 완충액에 보존제로 나트륨 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031461-100 Anti-NR6A1 Antibody, nuclear receptor subfamily 6, group A, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031461-25 Anti-NR6A1 Antibody, nuclear receptor subfamily 6, group A, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NR6A1 Antibody

Anti-NR6A1 Antibody

Target: nuclear receptor subfamily 6, group A, member 1 (NR6A1)
Type: Polyclonal Antibody against Human NR6A1


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NR6A1.
Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

CT150, GCNF, GCNF1, RTR


Target Information

항목 내용
Target Protein nuclear receptor subfamily 6, group A, member 1
Target Gene NR6A1
Verified Species Reactivity Human
Interspecies Identity Mouse (100%), Rat (99%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LILLSSLTVYSKQIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWYICQDFTE

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Storage Store at recommended conditions; gently mix before use

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.