
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOS1AP Antibody
상품 한눈에 보기
Human NOS1AP 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC 응용에 적합. CAPON(KIAA0464) 유전자 타깃. PrEST 항원으로 특이적 정제. 인체 반응성 검증 및 높은 종간 서열 유사성 보유.
- 카탈로그번호
- HPA030066-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030066-100 Anti-NOS1AP Antibody, nitric oxide synthase 1 (neuronal) adaptor protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030066-25 Anti-NOS1AP Antibody, nitric oxide synthase 1 (neuronal) adaptor protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOS1AP Antibody
Anti-NOS1AP Antibody
Target: nitric oxide synthase 1 (neuronal) adaptor protein
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NOS1AP.
Alternative Gene Names
CAPON, KIAA0464
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nitric oxide synthase 1 (neuronal) adaptor protein |
| Target Gene | NOS1AP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



