CacheBy
Atlas Antibodies Anti-NOS1AP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOS1AP Antibody

상품 한눈에 보기

Human NOS1AP 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC 응용에 적합. CAPON(KIAA0464) 유전자 타깃. PrEST 항원으로 특이적 정제. 인체 반응성 검증 및 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030066-100 Anti-NOS1AP Antibody, nitric oxide synthase 1 (neuronal) adaptor protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030066-25 Anti-NOS1AP Antibody, nitric oxide synthase 1 (neuronal) adaptor protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOS1AP Antibody

Anti-NOS1AP Antibody

Target: nitric oxide synthase 1 (neuronal) adaptor protein
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NOS1AP.


Alternative Gene Names

CAPON, KIAA0464

Open Datasheet


Target Information

항목 내용
Target Protein nitric oxide synthase 1 (neuronal) adaptor protein
Target Gene NOS1AP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HTGSKVSHPQEPMLTASPRMLLPSSSSKPPGLGTETPLSTHHQMQLLQQLLQQQQQQTQVAVAQVHLLKDQLAAEAAARLEAQARVHQLLLQNKDMLQHISLLVK
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.