Atlas Antibodies Anti-NOS1 Antibody

상품 한눈에 보기

인간 NOS1 단백질을 인식하는 토끼 폴리클로날 항체로, 신경형 질소산화효소 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, ICC 등 다양한 응용에 권장됩니다. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA069509-100 Anti-NOS1 Antibody, nitric oxide synthase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA069509-25 Anti-NOS1 Antibody, nitric oxide synthase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human NOS1, suitable for immunocytochemistry and related applications.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
```

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	ICC (Immunocytochemistry)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet