
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOS1 Antibody
상품 한눈에 보기
인간 NOS1 단백질을 인식하는 토끼 폴리클로날 항체로, 신경형 질소산화효소 연구에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, ICC 등 다양한 응용에 권장됩니다. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA069509-100 Anti-NOS1 Antibody, nitric oxide synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069509-25 Anti-NOS1 Antibody, nitric oxide synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOS1 Antibody
Anti-NOS1 Antibody
Target Information
- Target Protein: Nitric oxide synthase 1 (neuronal)
- Target Gene: NOS1
- Alternative Gene Names: nNOS, NOS
Product Description
Polyclonal antibody against human NOS1, suitable for immunocytochemistry and related applications.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000001130 (95%)
- Mouse ENSMUSG00000029361 (94%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Recommended Applications | ICC (Immunocytochemistry) |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| MSDS | Material Safety Data Sheet |
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



