
원본
Atlas Antibodies Anti-NOTO Antibody
상품 한눈에 보기
Human NOTO 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. PrEST 항원을 이용해 친화 정제되었으며, ICC 등 다양한 응용에 적합. 40% 글리세롤 기반 PBS 버퍼에 보존제 함유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA063906-100 Anti-NOTO Antibody, notochord homeobox 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063906-25 Anti-NOTO Antibody, notochord homeobox 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOTO Antibody
Anti-NOTO Antibody
Target Information
- Target Protein: notochord homeobox
- Target Gene: NOTO
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FQNRRVKYQKQQKLRAAVTSAEAASLDEPSSSSIASIQSDDAESGVDG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000068302 | 58% |
| Rat | ENSRNOG00000037863 | 52% |
Product Description
Polyclonal antibody against Human NOTO.
Recommended Applications
- ICC (Immunocytochemistry)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



