
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOS1 Antibody
상품 한눈에 보기
Human NOS1(nitric oxide synthase 1)을 인식하는 rabbit polyclonal 항체로, 신경세포 내 NOS1 단백질 검출에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 반응성이 검증되었습니다. ICC 등 다양한 응용에 사용 가능합니다.
- 카탈로그번호
- HPA058312-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058312-100 Anti-NOS1 Antibody, nitric oxide synthase 1 (neuronal) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058312-25 Anti-NOS1 Antibody, nitric oxide synthase 1 (neuronal) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOS1 Antibody
Anti-NOS1 Antibody
Target Information
- Target Protein: Nitric oxide synthase 1 (neuronal)
- Target Gene: NOS1
- Alternative Gene Names: nNOS, NOS
Product Description
Polyclonal antibody against human NOS1, designed for detection of neuronal nitric oxide synthase 1.
Recommended for use in immunocytochemistry and related applications.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat (ENSRNOG00000001130): 95%
- Mouse (ENSMUSG00000029361): 94%
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자 실험 환경에 따라 조정해야 합니다.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



