Atlas Antibodies Anti-NOS1 Antibody

상품 한눈에 보기

Human NOS1(nitric oxide synthase 1)을 인식하는 rabbit polyclonal 항체로, 신경세포 내 NOS1 단백질 검출에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human에 반응성이 검증되었습니다. ICC 등 다양한 응용에 사용 가능합니다.

카탈로그번호: HPA058312-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058312-100 Anti-NOS1 Antibody, nitric oxide synthase 1 (neuronal) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058312-25 Anti-NOS1 Antibody, nitric oxide synthase 1 (neuronal) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NOS1 Antibody

Anti-NOS1 Antibody

Target Information

Target Protein: Nitric oxide synthase 1 (neuronal)
Target Gene: NOS1
Alternative Gene Names: nNOS, NOS

Product Description

Polyclonal antibody against human NOS1, designed for detection of neuronal nitric oxide synthase 1.
Recommended for use in immunocytochemistry and related applications.

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
LVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAVDLSHQPPAGKEQPLAV
```

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to orthologs:

Rat (ENSRNOG00000001130): 95%
Mouse (ENSMUSG00000029361): 94%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand