
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOP58 Antibody
상품 한눈에 보기
Human NOP58 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. HSPC120, NOP5 대체명으로도 알려진 NOP58 ribonucleoprotein을 타깃으로 하며, 고순도 Affinity purification 방식으로 제작되었습니다.
- 카탈로그번호
- HPA021062-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021062-100 Anti-NOP58 Antibody, NOP58 ribonucleoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021062-25 Anti-NOP58 Antibody, NOP58 ribonucleoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOP58 Antibody
Anti-NOP58 Antibody
Target: NOP58 ribonucleoprotein
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independently validated)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NOP58.
Alternative Gene Names
HSPC120, NOP5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NOP58 ribonucleoprotein |
| Target Gene | NOP58 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016486 | 100% |
| Mouse | ENSMUSG00000026020 | 100% |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



