Atlas Antibodies Anti-NOP58 Antibody
Human NOP58 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. HSPC120, NOP5 대체명으로도 알려진 NOP58 ribonucleoprotein을 타깃으로 하며, 고순도 Affinity purification 방식으로 제작되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NOP58 Antibody
Target: NOP58 ribonucleoprotein
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, independently validated)
- ICC (Immunocytochemistry)
Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NOP58.
Alternative Gene Names
HSPC120, NOP5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NOP58 ribonucleoprotein |
| Target Gene | NOP58 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGL |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000016486 | 100% |
| Mouse | ENSMUSG00000026020 | 100% |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|