AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BGN Antibody
상품 한눈에 보기
Human BGN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인간, 생쥐, 랫트 간 높은 보존성을 보입니다.
- 카탈로그번호
- HPA003157-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA003157-100 Anti-BGN Antibody, biglycan 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003157-25 Anti-BGN Antibody, biglycan 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BGN Antibody
Anti-BGN Antibody
Target Protein: biglycan (BGN)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간 검증
- WB (Recombinant expression validation): 과발현된 표적 단백질을 이용한 웨스턴 블롯 검증
- ICC: 세포 내 단백질 발현 분석에 적합
Product Description
Polyclonal antibody against Human BGN (biglycan)
Alternative Gene Names: DSPG1, SLRR1A
Open Datasheet (PDF)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
Species Reactivity
| Species | Reactivity | Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Mouse | Predicted | 94% |
| Rat | Predicted | 93% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage & Handling | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.