
Atlas Antibodies Anti-BGN Antibody
상품 한눈에 보기
Human BGN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용하여 높은 특이성과 재현성을 제공합니다. 인간, 생쥐, 랫트 간 높은 보존성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BGN Antibody
Target Protein: biglycan (BGN)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직 간 검증
- WB (Recombinant expression validation): 과발현된 표적 단백질을 이용한 웨스턴 블롯 검증
- ICC: 세포 내 단백질 발현 분석에 적합
Product Description
Polyclonal antibody against Human BGN (biglycan)
Alternative Gene Names: DSPG1, SLRR1A
Open Datasheet (PDF)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
Species Reactivity
| Species | Reactivity | Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Mouse | Predicted | 94% |
| Rat | Predicted | 93% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage & Handling | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BHLHE22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BHLHB9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BGN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BFSP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BHLHA9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.