
Atlas Antibodies Anti-BHLHE22 Antibody
상품 한눈에 보기
인간 BHLHE22 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 독립 검증으로 신뢰성 높은 단백질 발현 분석 가능. Rabbit IgG 기반으로 높은 특이성과 재현성 제공. PrEST 항원 친화 정제 방식으로 순도 우수.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BHLHE22 Antibody
Target: basic helix-loop-helix family, member e22
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human BHLHE22
Alternative Gene Names
Beta3, BHLHB5, bHLHe22, CAGL85, TNRC20
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | basic helix-loop-helix family, member e22 |
| Target Gene | BHLHE22 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021745 (100%), Mouse ENSMUSG00000025128 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
AAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTENotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Safety Information
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BHLHE22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BHLHE22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BHLHE22 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BHLHB9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BGN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.