AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BFSP2 Antibody
상품 한눈에 보기
Human BFSP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 검증에 적합하며 독립적 에피토프 기반 검증을 통해 신뢰성 확보. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공.
- 카탈로그번호
- HPA062959-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062959-100 Anti-BFSP2 Antibody, beaded filament structural protein 2, phakinin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062959-25 Anti-BFSP2 Antibody, beaded filament structural protein 2, phakinin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BFSP2 Antibody
Anti-BFSP2 Antibody
Target: Beaded filament structural protein 2 (Phakinin)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human BFSP2.
Alternative Gene Names
- CP47
- CP49
- LIFL-L
- Phakinin
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Beaded filament structural protein 2, phakinin |
| Target Gene | BFSP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000032556 (83%), Rat ENSRNOG00000010899 (82%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
Antigen Sequence
LSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVE제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.