
Atlas Antibodies Anti-AUP1 Antibody
상품 한눈에 보기
인간 AUP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot에 적합. 고순도 Affinity 정제 방식으로 제조. 인간, 생쥐, 랫드 반응성 검증. 안정한 PBS/glycerol buffer로 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AUP1 Antibody
Target: ancient ubiquitous protein 1 (AUP1)
Type: Polyclonal Antibody against Human AUP1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human AUP1.
Affinity purified using the PrEST antigen as affinity ligand.
Optimal concentrations and conditions should be determined by the user.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ancient ubiquitous protein 1 |
| Target Gene | AUP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000007842 | 88% |
| Mouse | ENSMUSG00000068328 | 86% |
Additional Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Determine optimal concentration per application. |
| MSDS | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AVEN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AURKB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AUP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AURKA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AURKAIP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.