
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-AUP1 Antibody
상품 한눈에 보기
인간 AUP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot에 적합. 고순도 Affinity 정제 방식으로 제조. 인간, 생쥐, 랫드 반응성 검증. 안정한 PBS/glycerol buffer로 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA007674-100 Anti-AUP1 Antibody, ancient ubiquitous protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007674-25 Anti-AUP1 Antibody, ancient ubiquitous protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-AUP1 Antibody
Anti-AUP1 Antibody
Target: ancient ubiquitous protein 1 (AUP1)
Type: Polyclonal Antibody against Human AUP1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human AUP1.
Affinity purified using the PrEST antigen as affinity ligand.
Optimal concentrations and conditions should be determined by the user.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ancient ubiquitous protein 1 |
| Target Gene | AUP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000007842 | 88% |
| Mouse | ENSMUSG00000068328 | 86% |
Additional Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Determine optimal concentration per application. |
| MSDS | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



