Atlas Antibodies Anti-AUP1 Antibody

상품 한눈에 보기

인간 AUP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot에 적합. 고순도 Affinity 정제 방식으로 제조. 인간, 생쥐, 랫드 반응성 검증. 안정한 PBS/glycerol buffer로 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007674-100 Anti-AUP1 Antibody, ancient ubiquitous protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007674-25 Anti-AUP1 Antibody, ancient ubiquitous protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-AUP1 Antibody

Anti-AUP1 Antibody

Target: ancient ubiquitous protein 1 (AUP1)
Type: Polyclonal Antibody against Human AUP1

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human AUP1.
Affinity purified using the PrEST antigen as affinity ligand.
Optimal concentrations and conditions should be determined by the user.

Open Datasheet

Target Information

항목	내용
Target Protein	ancient ubiquitous protein 1
Target Gene	AUP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT

Verified Species Reactivity

Human
Mouse
Rat

Interspecies Information

Species	Gene ID	Identity
Rat	ENSRNOG00000007842	88%
Mouse	ENSMUSG00000068328	86%

Additional Information

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen
Notes	Gently mix before use. Determine optimal concentration per application.
MSDS	Material Safety Data Sheet