
Atlas Antibodies Anti-AURKA Antibody
상품 한눈에 보기
Human AURKA를 표적으로 하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 고순도 IgG 포맷으로 제공됩니다. 인체 반응성이 검증된 고품질 연구용 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AURKA Antibody
Target Information
- Target Protein: Aurora kinase A
- Target Gene: AURKA
- Alternative Gene Names: AIK, ARK1, AurA, BTAK, PPP1R47, STK15, STK6, STK7
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human AURKA.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat (ENSRNOG00000004479): 67%
- Mouse (ENSMUSG00000027496): 66%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AURKB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AUP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AURKA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AURKAIP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AUNIP Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.