CacheBy
Atlas Antibodies Anti-AVEN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AVEN Antibody

상품 한눈에 보기

인간 AVEN 단백질을 표적으로 하는 폴리클로날 항체로, apoptosis 및 caspase 활성 억제 연구에 적합합니다. Rabbit에서 생산된 IgG 항체이며, IHC 및 WB 응용에 추천됩니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020863-100 Anti-AVEN Antibody, apoptosis, caspase activation inhibitor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020863-25 Anti-AVEN Antibody, apoptosis, caspase activation inhibitor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AVEN Antibody

Anti-AVEN Antibody

개요

  • 타깃 단백질: Apoptosis, caspase activation inhibitor
  • 응용 분야: IHC (Immunohistochemistry), WB (Western Blot)
  • 항체 유형: Polyclonal Antibody against Human AVEN

Alternative Gene Names

  • PDCD12

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GPSRDSQKPTSPLQSAGDHLEEELDLLLNLDAPIKEGDNILPDQTSQDLKSKEDGEVVQEEEVCAKPSVTEEKNMEPEQPSTSK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000006419 63%
Mouse ENSMUSG00000003604 62%

항체 정보

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 설정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.