Thermo Fisher Scientific CPT1B Polyclonal Antibody
CPT1B 단백질을 표적으로 하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody입니다. WB 및 IHC(F/P) 응용에 적합하며, 고순도 항원 친화 크로마토그래피로 정제되었습니다. 인간, 마우스, 랫트 반응성으로 연구용으로 사용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CPT1B Polyclonal Antibody
Thermo Fisher Scientific CPT1B Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 3 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human CPT1B (197–226aa: DDEEYYRMELLAKEFQDKTAPRLQKYLVLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746181 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The CPT1B gene encodes a member of the carnitine/choline acetyltransferase family, functioning as the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. It facilitates transport of long-chain fatty acyl-CoAs from the cytoplasm into mitochondria. Multiple transcript variants encoding different isoforms have been identified, and read-through transcripts including exons from this gene are expressed from the upstream locus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.