Thermo Fisher Scientific CPT1B Polyclonal Antibody
CPT1B 단백질을 표적으로 하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody입니다. WB 및 IHC(F/P) 응용에 적합하며, 고순도 항원 친화 크로마토그래피로 정제되었습니다. 인간, 마우스, 랫트 반응성으로 연구용으로 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific CPT1B Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 3 publications |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to N-terminus of human CPT1B (197–226aa: DDEEYYRMELLAKEFQDKTAPRLQKYLVLK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746181 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The CPT1B gene encodes a member of the carnitine/choline acetyltransferase family, functioning as the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. It facilitates transport of long-chain fatty acyl-CoAs from the cytoplasm into mitochondria. Multiple transcript variants encoding different isoforms have been identified, and read-through transcripts including exons from this gene are expressed from the upstream locus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Torc1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TSLP Receptor Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CPT1B Polyclonal Antibody
581,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Carboxypeptidase B2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Carboxypeptidase A1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|