Thermo Fisher Scientific Carboxypeptidase A1 Polyclonal Antibody
Rabbit polyclonal antibody for detecting Carboxypeptidase A1 in human, mouse, and rat samples. Suitable for Western blot applications. Lyophilized form, reconstitutable to 500 µg/mL. High purity via antigen affinity chromatography. For research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Carboxypeptidase A1 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746178 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CPA1 (Carboxypeptidase A1), also known as CPA, is a 419 amino acid secreted monomeric protein that is highly expressed in pancreatic tissue.
Functioning as a pancreatic exopeptidase, CPA1 uses zinc as a cofactor to catalyze the release of C-terminal amino acids from various proteins, playing a key role in protein digestion and degradation.
It may also be involved in zymogen (proenzyme) inhibition, functioning to block enzyme activation pathways.
Abnormal levels of CPA1 are associated with pancreatic cancer, suggesting a possible role in tumor progression or suppression.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.