Thermo Fisher Scientific Carboxypeptidase A1 Polyclonal Antibody
Rabbit polyclonal antibody for detecting Carboxypeptidase A1 in human, mouse, and rat samples. Suitable for Western blot applications. Lyophilized form, reconstitutable to 500 µg/mL. High purity via antigen affinity chromatography. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746178 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CPA1 (Carboxypeptidase A1), also known as CPA, is a 419 amino acid secreted monomeric protein that is highly expressed in pancreatic tissue.
Functioning as a pancreatic exopeptidase, CPA1 uses zinc as a cofactor to catalyze the release of C-terminal amino acids from various proteins, playing a key role in protein digestion and degradation.
It may also be involved in zymogen (proenzyme) inhibition, functioning to block enzyme activation pathways.
Abnormal levels of CPA1 are associated with pancreatic cancer, suggesting a possible role in tumor progression or suppression.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CPT1B Polyclonal Antibody
581,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Carboxypeptidase B2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Carboxypeptidase A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific COL4A2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific COPE Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|