Thermo Fisher Scientific SECTM1 Polyclonal Antibody
마우스 SECTM1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 최적화됨. 합성 펩타이드 면역원 기반으로 제작되었으며, 항원 친화 크로마토그래피로 정제됨. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도 유지. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SECTM1 (118–152aa, KLHGFQAEFKNFNLTVNAADRQKTEDLPVTKVPDK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747082 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and is thought to be involved in hematopoietic and/or immune system processes.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific L-Selectin (CD62L) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific L-Selectin (CD62L) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SECTM1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SDHB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SDHC Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|