CacheBy
Thermo Fisher Scientific PDE5 Polyclonal Antibody
원본

Thermo Fisher Scientific PDE5 Polyclonal Antibody

상품 한눈에 보기

PDE5 단백질을 인식하는 Rabbit Polyclonal 항체로 Western Blot 및 IHC(P/F)에 적합. 인간 및 랫트 반응성. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 10:26
Thermo Fisher Scientific PA579796 PDE5 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PDE5 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution Publications
Western Blot (WB) 0.1–0.5 µg/mL -
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL -
Immunohistochemistry (Frozen) (IHC (F)) - 1 publication available

Product Specifications

항목 내용
Species Reactivity Human, Rat
Published Species Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20–63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions -20°C
Shipping Conditions Wet ice
RRID AB_2746911

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

Cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP]) are ubiquitous in mammalian cells and act as second messenger transducers mediating intracellular actions of various G protein-coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. These cyclic nucleotides play critical roles in multiple signal transduction processes.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.