Thermo Fisher Scientific PDE5 Polyclonal Antibody
PDE5 단백질을 인식하는 Rabbit Polyclonal 항체로 Western Blot 및 IHC(P/F)에 적합. 인간 및 랫트 반응성. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PDE5 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | - | 1 publication available |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20–63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746911 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP]) are ubiquitous in mammalian cells and act as second messenger transducers mediating intracellular actions of various G protein-coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. These cyclic nucleotides play critical roles in multiple signal transduction processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.