Thermo Fisher Scientific PDE5 Polyclonal Antibody
PDE5 단백질을 인식하는 Rabbit Polyclonal 항체로 Western Blot 및 IHC(P/F)에 적합. 인간 및 랫트 반응성. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | - | 1 publication available |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A (20–63aa QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746911 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP]) are ubiquitous in mammalian cells and act as second messenger transducers mediating intracellular actions of various G protein-coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. These cyclic nucleotides play critical roles in multiple signal transduction processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PDK1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PDE4D Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PDE5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PDCD4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PDCD10 Polyclonal Antibody, DyLight 488
661,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|