
Atlas Antibodies Anti-NOD1 Antibody
인간 NOD1 단백질에 대한 고품질 폴리클로날 항체로, 면역세포 신호전달 연구에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human 반응성 검증 완료, 다양한 응용에 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NOD1 Antibody
개요
Target Protein: nucleotide-binding oligomerization domain containing 1
Target Gene: NOD1
Alternative Gene Names: CARD4, CLR7.1, NLRC1
제품 설명
Polyclonal Antibody against Human NOD1
Host: Rabbit
Isotype: IgG
Clonality: Polyclonal
Verified Species Reactivity: Human
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSEInterspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000010629 (88%)
- Mouse ENSMUSG00000038058 (86%)
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
사용 권장
Recommended Applications: Immunocytochemistry (ICC)
참고
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Target Protein | nucleotide-binding oligomerization domain containing 1 |
| Target Gene | NOD1 |
| Alternative Gene Names | CARD4, CLR7.1, NLRC1 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Verified Species Reactivity | Human |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen |
| Recommended Applications | ICC |
| Antigen Sequence | NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
