Atlas Antibodies Anti-NOD1 Antibody

상품 한눈에 보기

인간 NOD1 단백질에 대한 고품질 폴리클로날 항체로, 면역세포 신호전달 연구에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human 반응성 검증 완료, 다양한 응용에 사용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA074367-100 Anti-NOD1 Antibody, nucleotide-binding oligomerization domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA074367-25 Anti-NOD1 Antibody, nucleotide-binding oligomerization domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: nucleotide-binding oligomerization domain containing 1
Target Gene: NOD1
Alternative Gene Names: CARD4, CLR7.1, NLRC1

Polyclonal Antibody against Human NOD1
Host: Rabbit
Isotype: IgG
Clonality: Polyclonal
Verified Species Reactivity: Human

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE

Highest antigen sequence identity to the following orthologs:

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Affinity purified using the PrEST antigen as affinity ligand.

Recommended Applications: Immunocytochemistry (ICC)

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

항목	내용
Target Protein	nucleotide-binding oligomerization domain containing 1
Target Gene	NOD1
Alternative Gene Names	CARD4, CLR7.1, NLRC1
Host	Rabbit
Clonality	Polyclonal
Isotype	IgG
Verified Species Reactivity	Human
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	ICC
Antigen Sequence	NYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDGGVKVLSE