CacheBy
Atlas Antibodies Anti-NOC4L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOC4L Antibody

상품 한눈에 보기

인간 NOC4L 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 높은 종 간 서열 동일성으로 신뢰성 있는 검출 가능. 안정적인 PBS/glycerol 버퍼에 보존제 포함.

카탈로그번호
HPA053424-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053424-100 Anti-NOC4L Antibody, nucleolar complex associated 4 homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053424-25 Anti-NOC4L Antibody, nucleolar complex associated 4 homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOC4L Antibody

Anti-NOC4L Antibody

Target: nucleolar complex associated 4 homolog
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human NOC4L.


Alternative Gene Names

MGC3162, NET49, UTP19

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein nucleolar complex associated 4 homolog
Target Gene NOC4L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000037478 (78%), Mouse ENSMUSG00000033294 (76%)

Antigen Sequence:
GVRRALGRRLEAVLASRSEANAVFDILAVLQSEDQEEIQEAVRTCSRLFGALLERGELFVGQLPSEEMVMTGSQGATRKYKVWMRHRYHSCCN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.