
원본
Atlas Antibodies Anti-NOD2 Antibody
상품 한눈에 보기
Human NOD2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC를 통한 Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공. 다양한 조직에서 RNA-seq 데이터와 비교해 단백질 발현 확인 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA054494-100 Anti-NOD2 Antibody, nucleotide-binding oligomerization domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054494-25 Anti-NOD2 Antibody, nucleotide-binding oligomerization domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOD2 Antibody
Anti-NOD2 Antibody
nucleotide-binding oligomerization domain containing 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NOD2
Alternative Gene Names
BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleotide-binding oligomerization domain containing 2 |
| Target Gene | NOD2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000055994 (73%), Rat ENSRNOG00000014124 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



