원본

Atlas Antibodies Anti-NOA1 Antibody

상품 한눈에 보기

Human NOA1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증된 반응성을 보입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035838-100 Anti-NOA1 Antibody, nitric oxide associated 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035838-25 Anti-NOA1 Antibody, nitric oxide associated 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nitric oxide associated 1 (NOA1)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot, Independent Antibody Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against Human NOA1.

C4orf14, hAtNOS1, hNOA1, MGC3232, MTG3

항목	내용
Target Protein	nitric oxide associated 1
Target Gene	NOA1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000036285 (75%), Rat ENSRNOG00000002055 (75%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)