CacheBy
Atlas Antibodies Anti-NOA1 Antibody
원본

Atlas Antibodies Anti-NOA1 Antibody

상품 한눈에 보기

Human NOA1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증된 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035838-100 Anti-NOA1 Antibody, nitric oxide associated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035838-25 Anti-NOA1 Antibody, nitric oxide associated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOA1 Antibody

Anti-NOA1 Antibody

Target: nitric oxide associated 1 (NOA1)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Independent Antibody Validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human NOA1.


Alternative Gene Names

C4orf14, hAtNOS1, hNOA1, MGC3232, MTG3

Open Datasheet


Target Information

항목 내용
Target Protein nitric oxide associated 1
Target Gene NOA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000036285 (75%), Rat ENSRNOG00000002055 (75%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent Validation
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.