
원본
Atlas Antibodies Anti-NOA1 Antibody
상품 한눈에 보기
Human NOA1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증된 반응성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA035838-100 Anti-NOA1 Antibody, nitric oxide associated 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035838-25 Anti-NOA1 Antibody, nitric oxide associated 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOA1 Antibody
Anti-NOA1 Antibody
Target: nitric oxide associated 1 (NOA1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Independent Antibody Validation)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human NOA1.
Alternative Gene Names
C4orf14, hAtNOS1, hNOA1, MGC3232, MTG3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nitric oxide associated 1 |
| Target Gene | NOA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENPNPPNWSRTVVRDVRLISAKTGYGV |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000036285 (75%), Rat ENSRNOG00000002055 (75%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



