CacheBy
Atlas Antibodies Anti-NDUFA8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NDUFA8 Antibody

상품 한눈에 보기

Human NDUFA8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 검증. 미토콘드리아 복합체 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041600-100 Anti-NDUFA8 Antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041600-25 Anti-NDUFA8 Antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NDUFA8 Antibody

Anti-NDUFA8 Antibody

NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa


  • IHC (Independent Validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Independent Validation)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human NDUFA8

Alternative Gene Names

MGC793, PGIV

Open Datasheet


Target Information

항목 내용
Target Protein NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Target Gene NDUFA8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000005668 (88%), Mouse ENSMUSG00000026895 (82%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.