
Atlas Antibodies Anti-NDUFA8 Antibody
상품 한눈에 보기
Human NDUFA8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. Human, Mouse, Rat 반응성 검증. 미토콘드리아 복합체 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFA8 Antibody
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human NDUFA8
Alternative Gene Names
MGC793, PGIV
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa |
| Target Gene | NDUFA8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000005668 (88%), Mouse ENSMUSG00000026895 (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDUFA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA13 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.