CacheBy
Atlas Antibodies Anti-NDUFA7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NDUFA7 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody against human NDUFA7. Validated for IHC and WB with orthogonal RNA-seq comparison. High sequence identity with mouse and rat orthologs. Affinity purified and supplied in glycerol/PBS buffer.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071866-100 Anti-NDUFA7 Antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071866-25 Anti-NDUFA7 Antibody, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7, 14.5kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NDUFA7 Antibody

Anti-NDUFA7 Antibody

Target: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5 kDa)
Type: Polyclonal Antibody against Human NDUFA7
Supplier: Atlas Antibodies


  1. IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  2. WB (Western Blot)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  3. ICC (Immunocytochemistry)


Product Description

Polyclonal antibody against human NDUFA7 (B14.5a).

  • Alternative Gene Name: B14.5a
  • Target Gene: NDUFA7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000006939 (91%)
    • Mouse ENSMUSG00000041881 (91%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Orthogonal Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.