Atlas Antibodies Anti-NDUFA7 Antibody
Rabbit polyclonal antibody against human NDUFA7. Validated for IHC and WB with orthogonal RNA-seq comparison. High sequence identity with mouse and rat orthologs. Affinity purified and supplied in glycerol/PBS buffer.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-NDUFA7 Antibody
Anti-NDUFA7 Antibody
Target: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5 kDa)
Type: Polyclonal Antibody against Human NDUFA7
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human NDUFA7 (B14.5a).
- Alternative Gene Name: B14.5a
- Target Gene: NDUFA7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000006939 (91%)
- Mouse ENSMUSG00000041881 (91%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.