
Atlas Antibodies Anti-NDUFA7 Antibody
Rabbit polyclonal antibody against human NDUFA7. Validated for IHC and WB with orthogonal RNA-seq comparison. High sequence identity with mouse and rat orthologs. Affinity purified and supplied in glycerol/PBS buffer.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFA7 Antibody
Target: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 7 (14.5 kDa)
Type: Polyclonal Antibody against Human NDUFA7
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human NDUFA7 (B14.5a).
- Alternative Gene Name: B14.5a
- Target Gene: NDUFA7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDG - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000006939 (91%)
- Mouse ENSMUSG00000041881 (91%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Open Datasheet (PDF)
Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|