
Atlas Antibodies Anti-NDUFA9 Antibody
인간 NDUFA9 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB에서 검증됨. Orthogonal 및 Recombinant Expression Validation을 통해 신뢰도 향상. Rabbit 유래 IgG 항체로 Affinity Purified 처리. Human 반응성 확인됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFA9 Antibody
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human NDUFA9
Alternative Gene Names
CI-39k, NDUFS2L, SDR22E1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa |
| Target Gene | NDUFA9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000000399 (85%), Rat ENSRNOG00000061684 (83%) |
Antigen Sequence:
RVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDUFAB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFA8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|