AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NCAPD2 Antibody
상품 한눈에 보기
인간 NCAPD2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 호스트에서 생산되었으며, WB와 IHC에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간에 대한 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036947-100 Anti-NCAPD2 Antibody, non-SMC condensin I complex, subunit D2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036947-25 Anti-NCAPD2 Antibody, non-SMC condensin I complex, subunit D2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NCAPD2 Antibody
Anti-NCAPD2 Antibody
Target Information
- Target Protein: non-SMC condensin I complex, subunit D2
- Target Gene: NCAPD2
- Alternative Gene Names: CAP-D2, CNAP1, hCAP-D2, KIAA0159
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human NCAPD2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000055300 (88%)
- Mouse ENSMUSG00000038252 (87%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.