
Atlas Antibodies Anti-NCAPD2 Antibody
상품 한눈에 보기
인간 NCAPD2 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 호스트에서 생산되었으며, WB와 IHC에 적합. PrEST 항원을 이용한 친화 정제 방식. 인간에 대한 높은 특이성과 재현성 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NCAPD2 Antibody
Target Information
- Target Protein: non-SMC condensin I complex, subunit D2
- Target Gene: NCAPD2
- Alternative Gene Names: CAP-D2, CNAP1, hCAP-D2, KIAA0159
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human NCAPD2.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
DKSVLVCKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWEAMLPELKSTLQQLLQLPQGEEEIPEQIA
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Rat ENSRNOG00000055300 (88%)
- Mouse ENSMUSG00000038252 (87%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NCAPH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPH2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NCAPH Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.